PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0026000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 887aa    MW: 97371.4 Da    PI: 6.3082
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0026000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.6e-28579630152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isle+l+ yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Spipo14G0026000 579 AEKTISLEVLKCYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 630
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.177567650IPR003035RWP-RK domain
PfamPF020421.1E-24582630IPR003035RWP-RK domain
SuperFamilySSF542771.24E-18793876No hitNo description
SMARTSM006661.6E-18794873IPR000270PB1 domain
PROSITE profilePS5174518.807794873IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.0E-22794872No hitNo description
PfamPF005641.6E-13795872IPR000270PB1 domain
CDDcd064077.05E-32795872No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 887 aa     Download sequence    Send to blast
MSEGGEEKPD DGPPLPLPPP VISGDAMDVD LELESSWSFD AGDFLRDSSI EYFLLSSSPL  60
GPLQSSLQFP QASPPQSPLL SFEQRVTEVS DAVPEISNLV PGICDPDDDV LPRSSSKARH  120
ISKAAKEETY DVSRIIKEKM THALRCFKDS IDQHVLVQVW APVKNGDRRV LTTSEQPFVL  180
DPHSISLLQY RTISLTYLFS VDGHSDGDLG LPGRVFSQQF PEWTPDVQYY SSKEYPRLTH  240
ALNHNVKGSL ALPIFESFYE TCVGVVELIM TSPKINYASE VDKVCKALEA VNLKSSKILG  300
HPSVQILNEG HQTAMSEILE VFTTVCEMHK LPLAQTWVPC KHGRCLPHDG DKNIIALGHD  360
KSCLEQSCMS TTNAAFYIVE PRMWGFRDAC AEHRLQKGQG VVGMAYSLRR PCFSSNITQF  420
GKNSYPLVHY ARMFGLVGCL AVCLQSCHTG NDVYVLEFFL PSECRSEMQQ LALLETISTT  480
IRQLIRSLKV VFKTETQEDI FDEILHMNGD LEDAPICNEA HKPCEGASVE IKGPEALTAS  540
RTDKKNTQKS DLKKGMTPAM MESQNPASPK TQERRRGKAE KTISLEVLKC YFAGSLKDAA  600
KSLGVCPTTM KRICRQHGIS RWPSRKIKKV NRSLSKLKTV IESVQGTGGA FDLQNAARVW  660
PQQLHKSHQN KSLENGNLNE LVGIHEGNEP PGIENNTTKA ASRQGQPSEV NSPQCLTKGQ  720
PSEGTEARPP SQGSCPGNSA NRRSSKEVPP SSPNAAHGVN PMLVEDSGSS KDLKSLCLSL  780
DDACPDALLP SASSVKVKAN YRGDIIRFRV KSSDGVFLLK EQVAKRLKLD LGAFDLKYLD  840
DDHEWVLLAC DADLEECLEV NGSQAIRLSV TDVASNPESF SGSSGG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008777047.10.0PREDICTED: protein NLP3-like
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0MTN60.0A0A0E0MTN6_ORYRU; Uncharacterized protein
STRINGLOC_Os01g13540.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein